DPCstruct | MC14964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 119 ± 19 aa |
| Standard deviation of domain lengths | 19.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.44 |
| Pfam Score | 99.67 |
| Assigned Pfam label(s) | PF02428- CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D5AIV7 | 5-126 | SKCAWVLALWLRLAMLQGSGAQVGAPSPSMDCTPALLSLADCLTFVEQGSNVTKPQGHCCSGFKKVVKKEVACLCEAFKGSSNFGIS… |
| V4TYT1 | 1-71 | MAISICNIESSKMNLCLPAVSGKSPTQPTEQCCAVVSGAKLSCLCSYKNLLPAFGINPKYALALPKKCGLE |
| M4CV56 | 10-126 | None |
| A0A6P5FSB9 | 222-330 | None |
| A0A6V7PIJ1 | 141-254 | None |
| A0A396I3M7 | 3-171 | None |
| A9T607 | 249-381 | None |
| A0A7I4C0D2 | 27-108 | None |
| A0A834SUI1 | 8-98 | None |
| A0A834SED2 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.