DPCstruct | MC14962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3FML6 | 1-101 | KKQFGFVPVYAQLCGRLELKEVDVLTAYTFTVLENQVLAAVKTVPLGQMAGQRILWHLHGRVPQAVEKALKLKDEQLSSALPRYAML… |
| C2XF00 | 1-130 | MISKSTSKLLCELFSFVNLNIYKENIMGNKLQGHPSIVYGILGAELKMTIEETLLVFLYSSVGSIIQNGVRAIPLGQTDGQKLLQEC… |
| A0A7W1ISE9 | 1-109 | None |
| A0A897MT87 | 2-102 | None |
| M1C8W8 | 57-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.