DPCstruct | MC14961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 85 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9QMD3 | 23-111 | IVGITFAVIQIANLSSQISGFASKNPCSDSDGGQNVIEQGIATDSSGSATDYCIDDLTLREYYCGNNVNYKDLDCSEYNGRVCSDGA… |
| A0A497TCE2 | 197-258 | KCIETDVGIDVYTKGSIFYGDLVTSDLCHVGKLIEYFCDGDELNWTLLDCPKNYTCVNGACI |
| A0A846Q272 | 155-225 | None |
| A0A2G9MDU3 | 29-120 | None |
| A0A2G9MDX8 | 127-209 | None |
| A0A3M0Y8R3 | 280-350 | None |
| A0A662QIM7 | 76-150 | None |
| A0A2H0YA10 | 191-256 | None |
| A0A662QMS7 | 459-533 | None |
| A0A0B3B7P3 | 99-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.