DPCstruct | MC1496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4R5K0 | 15-114 | VVKGEAEIMRNLTTVTWAHAVNNKTYLEAALSSEISMLEADIVLGQINGKSGPPIPIMAHPPAATSDLSLADFLTAVSQYNNVNSKQ… |
| A0A673FMD3 | 13-105 | LEFLLQIGEIQEKDGLYATWYHAANNKSEMNKALNSDVMILEADVNVKGYNTANETNIPIMAHPPDIYSDNTLEEWLEAVLKSKKGI… |
| A0A3L8S5M7 | 3-121 | None |
| S4R6E2 | 1-95 | None |
| A0A7M5XD71 | 98-213 | None |
| A0A6A4JWS9 | 351-454 | None |
| A0A3B4ANX5 | 50-141 | None |
| T1GB54 | 9-94 | None |
| B7FS91 | 6-97 | None |
| A0A162SJN3 | 340-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.