DPCstruct | MC14958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 223 ± 17 aa |
| Standard deviation of domain lengths | 16.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3MAT1 | 2-200 | QYVKDKNGNRTQVYTNGGFLVGGTVSALNSYNNGQMITAQTGDIFNPANGPLANYLNMGDSGSPLFAYDSLQKKWVLIGVLSSGTNY… |
| A0A3S4HG97 | 1-229 | MTQSGMVSGAYSDKNRYPAFYRVGSGTQEIRDTNGHITSISGAYSYLTGGTAGSLGSYDQGKMISTNTNNQLYSLAQGPMGTHPRSG… |
| A0A378NJC0 | 173-399 | None |
| A0A378F342 | 134-361 | None |
| A0A4U8SYW9 | 59-268 | None |
| A0A2X5PFE9 | 127-355 | None |
| A0A8B4HDH2 | 173-400 | None |
| A0A246W9C2 | 174-400 | None |
| A0A6N4RI82 | 34-206 | None |
| A0A6L6ZXX3 | 8-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.