DPCstruct | MC14957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 63.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A231HLG2 | 1-67 | MASKSVAKEAEEIILASEMIALGARLQVLQAETSLSYDRLARLYREIKGASPPKGMLPFSVDWFMTW |
| A0A3S4G188 | 1-61 | MSEKSIVQEARDIQLAMELINLGARLQMLESETQLSRGRLIRLYKELRGSPPPKGMLPFRQ |
| A0A1H9IKH5 | 1-53 | None |
| A0A6N7B8B9 | 1-67 | None |
| A0A1B0C1Q4 | 2-61 | None |
| A0A1I0AWZ9 | 1-61 | None |
| A0A844EZE0 | 1-68 | None |
| X1WPV0 | 149-215 | None |
| A0A455TZG0 | 1-71 | None |
| A0A1A9X6T3 | 2-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.