DPCstruct | MC14953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 11.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A514XFM2 | 676-772 | AETLATLLKNHGPESKCIVWAHNSHIGDYHATDMAGQGYVNLGGIAREQFGIQEVSLVGFGTYQGKVIASHSWEGKETEMNLPPAPA… |
| A0A370FUH6 | 1-94 | MADTLDALIAHLDRHEDNSSRVVVWAHNSHVGDARATEAGAHGELTLGHLIRERHRDQCRLIGFTTHHGTVTAASEWGGIAERKIVR… |
| A0A2T4H342 | 170-251 | None |
| K0IEE7 | 58-164 | None |
| A0A1Q7BWS4 | 1-104 | None |
| A0A094GSH5 | 264-358 | None |
| A0A533UDX1 | 1-91 | None |
| A0A2P9H9Q9 | 144-247 | None |
| A0A498EXG9 | 43-172 | None |
| A0A291RP13 | 31-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.