DPCstruct | MC14952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 326 ± 56 aa |
| Standard deviation of domain lengths | 55.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 96.01 |
| Assigned Pfam label(s) | CL0020- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0L1U0 | 261-586 | TELSEADQKALGLIVKAAKVIDDIFYEQLWHSNPALRDWLKDHANASELDRLKWKYFLINKSPWSSLDENEPFLTTADSAAKLLPEA… |
| A0A1Q3EA66 | 21-402 | SLDISKTFAQLSSQEKKYTHHVSEAAWAGARIIQAQWTPQANDLYDLLILTFSDDGKLADLQKLQSASRLTAEEWEDIMQYTVQVLS… |
| A0A195CKP0 | 28-280 | None |
| A0A4S8IV71 | 108-411 | None |
| A0A3N7GNP8 | 2-265 | None |
| D3UHI6 | 253-541 | None |
| K3WS69 | 2-474 | None |
| A0A2G4I3V0 | 35-377 | None |
| W4PGF2 | 35-356 | None |
| A0A1R0H2A2 | 329-600 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.