DPCstruct | MC14951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 210 ± 28 aa |
| Standard deviation of domain lengths | 27.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF01486- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0KSP3 | 1-242 | MITVPCNFCEFSSSSSRSRYGCISEEESLDEAAVQLRKEVEKLRLLIKRMNGKDECASFTELTELISHLRSVQCIVLSQQEKVKIEE… |
| A0A384LBR4 | 2-175 | ENELKRLRLLTRRMTCKDLDGLTFPELLSLKSHLQTALLIVKDQTKKIEQLLKEDDGWMLIRRKDAEDGMGREVSVPCKFSTSSTGE… |
| V4MJT4 | 20-270 | None |
| A0A087H4F5 | 672-880 | None |
| A0A087HKB4 | 27-199 | None |
| M4DK90 | 1-215 | None |
| A0A1P8B058 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.