DPCstruct | MC1495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 199 ± 22 aa |
| Standard deviation of domain lengths | 22.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0156 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q17MI8 | 60-276 | GSNPIQEMRLEKGIPPTYPLQWFAANKWNKPPITLPGPRAGANLNDYYHIITNTYRRESVSVTSSLTFLQLLCRQITGLLRFDWVSL… |
| A0A5E4R588 | 1-210 | MAVSLKRTHSVHIVSRKKVDFKYVDSDSIVDYPRDWFQRQPGARPPAIIPTCNLSTEDIYAAARGGIRSASLSLSTAKLVLHNFGQT… |
| S4PDL9 | 2-210 | None |
| Q17Q60 | 1-205 | None |
| B7QBH0 | 1-237 | None |
| B0WS86 | 38-235 | None |
| Q0IGC6 | 2-166 | None |
| A0A811X7M9 | 1-177 | None |
| A0A183EDG3 | 14-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.