DPCstruct | MC14949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4PRN2 | 132-206 | LVAAAQKTNRLELAHKAIEIAETRLMQDKWPEYYDGKNGRLIGKEARIYQTWTIGGYLVAKDLISNPRHLELLCF |
| A0A6J0KLW6 | 67-157 | LWQLTATCIKTGRPQIARRAVDLIESRLHRDCWPEYYDGKLGRYVGKQARKYQTWSIAGYLVAKMLLEDPSHIGMISLEEDKLMKPV… |
| A0A164Y197 | 511-596 | None |
| A0A6A2YXH2 | 605-687 | None |
| A0A2N9IC49 | 429-509 | None |
| A0A835RKQ7 | 36-141 | None |
| A0A0B2P5G1 | 527-631 | None |
| A0A4S8IQ18 | 902-1004 | None |
| A2ZSM4 | 4-110 | None |
| A0A314YGW1 | 139-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.