DPCstruct | MC14947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9GDD7 | 55-116 | KINIPDYMTIKEFADRISVKPAEIIKWLFLRGKIADFKSAICFDDMREFADGYGFICEKETE |
| A0A0G1KT06 | 6-81 | QELNPQPENTPPSKPEIMLSPVMKVTDLAELLHQPVTEVIRYLLKNGVLVTLNDNLDFETAAIVADDFGYKAVLGE |
| A0A0G1N3V4 | 1-70 | None |
| A0A485AL13 | 196-274 | None |
| A0A0G0QX17 | 54-135 | None |
| A0A7H1NQM9 | 5-102 | None |
| A0A380FGA6 | 54-133 | None |
| A0A3B8TKJ3 | 363-454 | None |
| A0A212DMT5 | 454-548 | None |
| J3Z140 | 2-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.