DPCstruct | MC1494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 14.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1WN17 | 2-142 | SLPGNGIFVVQGEMWMLVTAMRRSTRWGSHSFPNEEYDVLMRTFQDLKTILNQVEDLRLLDPATYLSPFLEVIRSKETTGPVTSLAL… |
| A0A5E4QZ39 | 2-140 | SMPGNGILVVQGEMTMLVTAMRRSTRWGSHSFPNEEYDMLMRTFQDLKTILNQVDDLRLLDPPTYLSPFLEVIRSKETTGPVTSLAL… |
| A0A446N5W3 | 11-147 | None |
| A0A3Q0J0I0 | 3-140 | None |
| A0A5K1JZS1 | 18-189 | None |
| A0A7R9FV00 | 1-140 | None |
| A0A3F2RWQ3 | 4-154 | None |
| A0A448X9X4 | 3-133 | None |
| A1Z8W8 | 1-158 | None |
| A0A0B2V902 | 216-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.