DPCstruct | MC14937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 206 |
|---|---|
| Mean domain length (aa) | 130 ± 24 aa |
| Standard deviation of domain lengths | 23.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.94 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | PF09174- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6JWC8 | 15-141 | EFPDEFYYHEKDHIWAKVEDNKVTFGLDAFGTWGAGGIKQMRTFPLGRTLKKNQAFGNIESGKYIGPMRAPVSGKIIEVNTDVVSNP… |
| A0A497GD91 | 9-132 | PRDRRYHEKHAWIKVIEGKRARIGITDYAQKKLKSIVFVEPPEVGGRVEAGELLATVESIKAVGEVYAPVSGKVVAYNEKLDDDPGL… |
| A0A7C1I1P1 | 6-111 | None |
| A0A7C4LXI8 | 239-370 | None |
| A0A7R8X6X3 | 221-376 | None |
| A0A2I1E5Z7 | 28-167 | None |
| A0A812IXX6 | 15-167 | None |
| A0A1J3GP11 | 18-111 | None |
| A0A212CMI7 | 12-128 | None |
| A0A2H0HIR2 | 267-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.