DPCstruct | MC14936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 150 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497G8M9 | 1-157 | MRSLSYDLSRFNPEFWRRPRSFLRDAHRRGVGVQIELWDPHDFWDWGPSGLWSKNPWNPSMNVSYGAGDTILSERWPHHPSEKPNPF… |
| A0A7C4SSH4 | 103-236 | KFNLYEFEESYFSRLRHRVEMAAERGIYVSIMLFEGHCAQFAVQGWEFHPFHPDNNVNGVDGGRLEYYTLNNEAVLALQESYVRKVI… |
| W4VJX0 | 76-218 | None |
| A0A3D3USP1 | 101-252 | None |
| A0A7X7YVW9 | 97-251 | None |
| A0A6C1S1N0 | 855-1016 | None |
| X1VRV8 | 1-148 | None |
| A0A7Z9ZYC0 | 246-386 | None |
| A0A6C1RZZ5 | 589-748 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.