DPCstruct | MC14930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 137 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078H1H5 | 1-150 | MWPLIDAQKGKWYSPDLSSSSFQGLQGYNVLLSLSLSLSLSLSRTYVRTLGRTVVGLYKQFKDRDAFPVNDRSTPTTVTISYDDKRR… |
| A0A1U7VQ34 | 17-157 | MWPMIEAKKGDWYSDHLSASSLHCIQGYRVFIAIAMMFGDGLFHFAYMLVVTALSFQKRKEEDESGEESLEDYDTKRKNEYSLKDQI… |
| A0A803L2F2 | 29-172 | None |
| A0A3B6AZG8 | 304-444 | None |
| A0A0E0A6K6 | 232-351 | None |
| A0A816VQ03 | 1-128 | None |
| A0A287XHG5 | 66-214 | None |
| A0A833VF54 | 200-326 | None |
| A0A804MAU1 | 22-176 | None |
| A0A833QA76 | 96-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.