DPCstruct | MC1493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 106 ± 14 aa |
| Standard deviation of domain lengths | 14.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1HCG3 | 1-89 | MSRSVTVAVAYIMTVTSLNWKEALKVVRVGRSVANPNTGFQKQLEEFEMTKLYEERRRLKERFPSLALSATDEAECQILLNSYEGLL… |
| A0A5E4QYW5 | 1-107 | MSRSVTVAVAYIMSVTTLNWREALKVVRAGRAVANPNLGFQRQLQDFETYKLVEERRRLKERYPSLALADRDMMECQVMLTSYQTML… |
| A0A183THV9 | 15-160 | None |
| A0A3Q0J216 | 70-194 | None |
| T0NRW5 | 158-250 | None |
| A0A2W1BR11 | 39-144 | None |
| A0A5E4CEG2 | 46-143 | None |
| A0A7R9CUM8 | 74-179 | None |
| A0A0J7KKV1 | 1-115 | None |
| A0A3Q7SL95 | 66-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.