DPCstruct | MC14928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 99 ± 22 aa |
| Standard deviation of domain lengths | 21.84 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4J220 | 359-447 | PPPVVDNSPFASMFADANVLTPEHKSLIEQFLSGQPVTHPDAVDGVYQVTLSEKRTIDANLDEFAEVVVFEMNFATGSWRKLKRRKK… |
| A0A2K6TIF9 | 9-107 | QPKKNLSLTREQMFAAQEMFKTANKVTRPEKTLILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTAFEMNYGT… |
| I4DKS4 | 52-149 | None |
| A0A1Z5JH58 | 416-534 | None |
| A0A182EJE6 | 2-85 | None |
| A0A1S8X5Y0 | 438-527 | None |
| A0A1S8VGP3 | 432-518 | None |
| V5IBZ7 | 1-81 | None |
| A0A5N5SIG3 | 341-442 | None |
| A0A182QX16 | 7-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.