DPCstruct | MC14923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 188 ± 35 aa |
| Standard deviation of domain lengths | 34.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420MYD8 | 16-165 | DRYMAHVFDNWTSADPVPMPKEPVYTFSVSAVPVGHFKEDLPDEVPSGNRKKDASAWLMVKRGGDKTGFLWCDTDGKPADKKYIQMA… |
| A0A135S3N1 | 2-219 | RLLKKESDLSEEEKKIPEKWIKELTACNRMGDIGADDVRGKIWDCVFDHWNTNKKVPQPSKASKRRIADRIVHVGFLTADAPLAKRR… |
| W3XBV4 | 5-203 | None |
| A0A4Q4YEQ6 | 9-208 | None |
| A0A2C6ADP1 | 65-246 | None |
| A0A2C6AE23 | 91-328 | None |
| A0A420SYJ4 | 2-161 | None |
| A0A3M9Y4U8 | 264-465 | None |
| A0A365MJI0 | 126-333 | None |
| A0A395RTJ3 | 161-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.