DPCstruct | MC14922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 172 ± 29 aa |
| Standard deviation of domain lengths | 28.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1JIJ3 | 42-204 | EEQRRREAAEQAQKEEQRRREEEQRRREEEQRRREAVEQAQDRAEEKTRKTTLPEFLDACHTHLHSGLTVQTDATLSTRGDPANATN… |
| A0A135RP84 | 12-175 | DRREEEQRRREEAEELAKASKPQTLQKYLASCHSLSLAIQVVTDRTLTTQGDTTNPTGRIFPRRIIPWDDFATRQGEIWDQLSNSGT… |
| Q2U9S6 | 27-182 | None |
| A0A4Q7JM35 | 44-201 | None |
| Q2GZ78 | 5-174 | None |
| A0A167NV75 | 74-290 | None |
| A0A2H3GCV1 | 82-275 | None |
| A0A7R7WBE2 | 2-121 | None |
| A0A1V6TDR9 | 8-141 | None |
| A0A401KZ32 | 15-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.