DPCstruct | MC14921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 53 ± 6 aa |
| Standard deviation of domain lengths | 5.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 68.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2KNX2 | 17-62 | YECLRAELRKMAPPNGRAILLFRAKCGCPVAKLEGWGLKRGRRHKK |
| A0A7J0GU61 | 33-87 | KGGSEGNLDYECLRAELRKMAPPNGRAVLLFRARCGCPIAKLEGWGTKRCRRHKK |
| A0A2U1MZ57 | 192-254 | None |
| A0A1D6N8X2 | 166-216 | None |
| A0A7J9HTF0 | 101-154 | None |
| A0A7J0EEK8 | 97-148 | None |
| A0A453FSQ5 | 6-51 | None |
| M8C8L6 | 14-67 | None |
| A0A368QHA6 | 277-327 | None |
| J3L572 | 55-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.