DPCstruct | MC1492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 139 ± 21 aa |
| Standard deviation of domain lengths | 21.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | PF10228- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3PZ98 | 168-280 | DSRGEVAARFGREWGMELPESIFRFQAFLHSLPSVGHDALEQLELMPYGIMSLVEDPAWQPKDGGDPRMYLRAYRDPPEFVPFMHGG… |
| A0A5E4QYH3 | 77-214 | IESSERWDCKESTQHLKNSTLDINEDSLLSIVEVDGDTTLYGNETDNRIFKECFLVEMPNDFFKFYECLCKESSSVESLMASVNLEL… |
| U6L5W1 | 38-183 | None |
| A0A7R9KC60 | 240-398 | None |
| K3WN34 | 4-143 | None |
| A0A4Y7M401 | 80-243 | None |
| A0A0R3T9X4 | 1-130 | None |
| A0A2P8YE00 | 97-234 | None |
| A0A2J7PZ22 | 45-186 | None |
| S9X862 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.