DPCstruct | MC14919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 264 ± 34 aa |
| Standard deviation of domain lengths | 34.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5K7A4 | 77-333 | FFRSSRELWTILLGRSALRELNQIEAELNKHWQRLLEGLSYYKPPSPNSAEKVKANKDVASPLKELGLRISKFLSLDEEQSVQLLQC… |
| A0A6N2KL41 | 1-263 | MVSPKQLLSTIESTLLNPSPPSASERVELMHAIRSSLPSLQALLFYPPPKPSDRAQIVQSKEVRLPDSPAISLDDQDVQIALKLSDD… |
| A0A0F8AE74 | 351-592 | None |
| A0A2G8L4V0 | 50-343 | None |
| B8PIK2 | 14-278 | None |
| A0A1Q9DYS0 | 2-260 | None |
| D3BJS9 | 7-260 | None |
| E7EXJ6 | 7-280 | None |
| A0A177WS89 | 24-314 | None |
| A0A498IW40 | 1-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.