DPCstruct | MC14918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 326 ± 75 aa |
| Standard deviation of domain lengths | 74.55 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 87.76 |
| Assigned Pfam label(s) | CL0028- PF18117 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9SU72 | 130-555 | ILATVWYLEKYFIRNPNVYLEPRCVTFGAPLVGDSIFSHALGREKWSRFFVNFVSRFDIVPRIMLARKASVEETLPHVLAQLDPRKS… |
| A0A6N2KK78 | 76-422 | ILECSTWNSCFLHVAGNKDLFPKASISHNDTTQSAIEEYKAFETFILCSERGCACVDDLEVVSRLLESTQRQDSCEAQEIDYYVEMV… |
| A0A7C9DYC5 | 1-316 | None |
| A0A6A3B3T9 | 160-497 | None |
| A0A7J0E8T6 | 28-392 | None |
| A0A816J5H4 | 7-375 | None |
| A0A1D1XGX1 | 62-394 | None |
| A0A0L9VP11 | 169-598 | None |
| A0A5N6NB21 | 455-794 | None |
| I3SVX6 | 2-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.