DPCstruct | MC14917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 167 ± 25 aa |
| Standard deviation of domain lengths | 25.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811WBT9 | 19-171 | CLEVGAEYRKELAEARGQTVAPPLLMAAFGAASPEDFLMETVKRIRSSDLEEALILLPFKSACDVVKMLPSLLDRGDNTELLCRLAI… |
| A0A6N2KG93 | 11-145 | QRIAEHQEENTTGNVTEYQPNVVMLGLSPSNYVLRAFTNIHTNDLEQALLALPFSDGLKLLSYFKDWTSNPDKVELVCRVTTVLLQT… |
| A0A0A9VPL3 | 1-138 | None |
| A0A2I0T8P5 | 132-322 | None |
| A0A7S3SNX5 | 38-258 | None |
| A0A7R9T7X9 | 124-247 | None |
| A0A182YNC9 | 1073-1251 | None |
| A0A2H9TL50 | 812-983 | None |
| A0A183X9K9 | 2-145 | None |
| A0A817MB69 | 9-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.