DPCstruct | MC14916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 202 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7ZW88 | 150-349 | LLIQELAEILTDSNFQEKGMKLLQSLLLFQYLVIVLEGDFLPRNATMNWSLQRKSWLNMLLGSRKINYKSLMKNCIEVICLLCQPFE… |
| A0A6N2KEQ7 | 24-210 | IKSLRNMLLFQYLINALEGDFLPRNRVYEETMNWTHLRESLLNLLLSTRKINYKGLMKDCLTIMCGLFDVSAGISEDLESPDNAAAK… |
| A0A6N2M0C7 | 2-190 | None |
| A0A0A9CPF5 | 14-200 | None |
| A0A067GQT0 | 79-299 | None |
| A0A834LWA0 | 2-205 | None |
| A0A835VJE6 | 145-336 | None |
| A0A453P0V5 | 35-224 | None |
| A0A5J5NAE1 | 40-266 | None |
| A0A2T8KVC2 | 85-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.