DPCstruct | MC14915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 132 ± 25 aa |
| Standard deviation of domain lengths | 24.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.34 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | PF18784- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MKL8 | 24-151 | SKLRMLMICRMAKPEEVLIVEDENGNIVRETMKDNDVLVQYKIMRETLIYLSHLDHEDTEQQMLKKLTKQLNGEDWSWNNLNTLCWA… |
| A0A6N2KDR0 | 9-129 | ICRMAKPEEVLIVEDENGNIVRETMKDNDVLVQYKIMRETLIYLSHLDHEDTEKQMLKKLSKQLSGEDWNWNNLNTLCWAIGSISGS… |
| A0A3P6RVX3 | 2-122 | None |
| A0A396GBZ6 | 150-250 | None |
| A0A7J7VWS2 | 8-153 | None |
| A0A453MKK8 | 95-196 | None |
| A0A7S7LHW1 | 490-650 | None |
| A0A7J7IJG7 | 102-245 | None |
| A0A7S0M3Z2 | 24-151 | None |
| A0A818H481 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.