DPCstruct | MC14914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 54 ± 8 aa |
| Standard deviation of domain lengths | 7.61 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 63.07 |
| Pfam Score | 95.86 |
| Assigned Pfam label(s) | PF00177- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I7I7W8 | 118-175 | VYIPGIGHNLSTHSVVLVRGGRCRDLPGVYYKAIRGKYDLLPVKNRTTSRSKYGVKID |
| A0A6N2KBY3 | 82-132 | LQEHSMVLIRGGRVKDSPGVKSHCIRGVKDLLGIPDRRRGRSKYGAEKPKS |
| A0A445CQA9 | 47-110 | None |
| A0A832II50 | 16-66 | None |
| A0A2D3VME9 | 116-166 | None |
| A0A6L7MIL0 | 79-136 | None |
| A0A650AZH8 | 45-82 | None |
| A0A218WZW4 | 55-105 | None |
| G7J101 | 109-162 | None |
| A0A812Z639 | 263-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.