DPCstruct | MC14913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 52 ± 3 aa |
| Standard deviation of domain lengths | 2.64 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836H1N4 | 20-72 | HGARDHGVRCVFRKYRYALPFENSIEDDYVTEKVYNALLSGALPLYIGAMDIA |
| A0A1X0NRC1 | 10-59 | GRYPQKLCVFRKYKYAMALENSRERDYVTEKVYHALLSGAIPLYWGAPNI |
| A0A843VC34 | 14-64 | None |
| A0A0L8HBZ7 | 101-157 | None |
| A0A7S2G2R2 | 25-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.