DPCstruct | MC14912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Standard deviation of domain lengths | 15.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 46.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136LF21 | 1-147 | MPHKNEIDLEAHRDALLAILQPVADDSAYDERRINKLVQKYGRMDGGRFFSRDELIRAYRQFAGNYLPPFDASVIERLRMKPVRSAS… |
| A0A6N2K4F0 | 12-149 | LPRPGRGGYRPHGLTEEEARVRAIAEIVNSMADLSRKNQTVDLNALKSAACRKYGLARAPKLVEMIEALPDSDRESLLPKLRAKPVR… |
| A0A5N5I3Y9 | 10-152 | None |
| A0A0R3TD52 | 1-144 | None |
| A0A1R0GUE2 | 286-448 | None |
| A0A0G0S782 | 20-134 | None |
| A0A2G2X857 | 16-153 | None |
| A0A388KW21 | 22-154 | None |
| A0A0M8MY17 | 2-131 | None |
| A0A534LJW5 | 195-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.