DPCstruct | MC1491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7HA60 | 5-91 | IEIDENNIPQIQLGEHLMRLDAEELGPKDKKRAEEEIRETPENVAYGLKKIREFIEAEPDFDVPLNDDTFLIKFLRPCRYIPENAFK |
| A0A5E4QXG2 | 1-99 | MGLRYEADGTPYVHWNGHKIKLEREPLNEITFIEKAEKELRETPENVEKALKELRELLKGETNLVIPFEDDDFLMKFLRPCKFYAES… |
| A0A084VLY8 | 1-80 | None |
| A0A7R9HRK6 | 88-173 | None |
| A0A0K8WKZ5 | 9-108 | None |
| H9J0U1 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.