DPCstruct | MC14909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 2 aa |
| Standard deviation of domain lengths | 2.27 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 94.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855SI60 | 116-181 | ALVLDGSANIRGSFSQENGRLTIQGHPVIHASTSQSVANTVASQGDNSVLTQPTSFTQDDWENRTF |
| A0A5Y9KKR5 | 9-73 | LIFDGNIYNKEGVFRTENAKLNFQGHARIHAYVSKEQAKKLQEHGLSALTKPVSFTQEDWEDRVL |
| A0A5L8TQV5 | 1-65 | None |
| A0A855SIZ0 | 116-181 | None |
| A0A377D386 | 18-86 | None |
| A0A0H3PAZ5 | 112-178 | None |
| A0A509D1P8 | 168-234 | None |
| A0A811ARL0 | 5-77 | None |
| A0A811AQ47 | 59-124 | None |
| A0A5Z0YN40 | 450-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.