DPCstruct | MC14904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 198 ± 22 aa |
| Standard deviation of domain lengths | 22.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2WYN5 | 87-279 | GHELRRSPSLEEYYRFRAQALNLVRRSCGGDSDHYLELKRIADTKETSTNSYYLISCIGILRAAQRDFASGLLFDMRALISAEVLGD… |
| A0A7V9NWR3 | 29-230 | NGSDTADEKVQELTKWTNLSGELIFKLYPNKSSQYNSHFQHYRAKMEMTRLHSNNYQPLLELMGVLEAIKYELESGLINKLKTLIQA… |
| A0A0Q5U9R1 | 2-164 | None |
| A0A532V9L8 | 57-243 | None |
| A0A7Y4TP01 | 26-211 | None |
| A0A2N1PC53 | 14-195 | None |
| X1S8D8 | 81-268 | None |
| A0A4T0UM44 | 2-243 | None |
| U2DEX4 | 38-266 | None |
| A0A0F9BMS6 | 24-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.