DPCstruct | MC14902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 454 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 69.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4N5X7 | 1-453 | MKVYLQGRKVQTKRLLSTLHSTRRYNFASKTFRTRAEADLAKAKNDVKIAELRAQESESKARDCELRYQGSEDPEHLRQVRRLRNTA… |
| A8WVA9 | 1-474 | MKCNLESCSDSSLVISTSVERQKTLLLSENAEYYNEENRHDEGSERKRMARTQLVKYNADIRICETEIAVAKAEKGKSMKAVIGLHV… |
| A0A2G8LFH6 | 160-611 | None |
| A0A455AZN6 | 253-719 | None |
| A0A6P8HM61 | 264-704 | None |
| A0A834CC39 | 101-569 | None |
| A8WIV0 | 612-1045 | None |
| A0A061I3S5 | 220-651 | None |
| A0A7N5KQZ0 | 59-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.