DPCstruct | MC14900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03380 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3MTZ2 | 8-123 | CKTCAKVYDSTCQGTGIPSPSNWCATASDVGVSYTLGPIDPEYWVYNTEDDTCWTILSCPSGTLARYLLTGGITSEGNYGGMETVSF… |
| A8WUL3 | 2-93 | PSPSMYCLTAAEVPVSYTLGGCSTCGIPLDSCQTTLACPSGTAARLDGGSGDINGNSDGSPTFLYCSEAAGLWYGRIDGSDTPIISA… |
| A0A016TY13 | 89-191 | None |
| A0A2G5TCK3 | 70-199 | None |
| A0A2G5TCH6 | 326-443 | None |
| A0A1I7TUR9 | 2-106 | None |
| K8ESN2 | 193-297 | None |
| A0A0B1TEM9 | 1-96 | None |
| G0MSW8 | 25-138 | None |
| B1GRL1 | 51-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.