DPCstruct | MC1490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 76 ± 13 aa |
| Standard deviation of domain lengths | 13.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.95 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 66.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07896 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813YC90 | 1-99 | MLSRLYSSLSCSINIQRSFVLRNALRLHSTASKDSKKSSTKGKTPMGKLDEDSHPDAQKQPLKPWPNNVNPHTGEINGPSGPEPTRY… |
| B4GK12 | 124-195 | LSERYLKFREKLRSEAPVTCLPKGAPHPAHEKDPLVPWPNNTNPHTGEVGGPAGPEPTRYGDWERKGRVTDF |
| A0A7R9EZ36 | 2-59 | None |
| A0A6A0GUE4 | 1-66 | None |
| B4Q5J6 | 20-91 | None |
| A0A1Y1KPU2 | 22-111 | None |
| A0A3B0K5E9 | 89-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.