DPCstruct | MC149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1UNI7 | 24-79 | TERSRAQVNAFLRQQGLTRTPPGYEVDHIMPLCAGGKDSPENMQLLTKEQHKAKTR |
| A0A519KI73 | 1-56 | MVRNKAAVYQFKKQTGYPNGRPGYVIDHIVPLKKGGCDCPENMQWQTIKEAKAKDA |
| A0A4R3UI85 | 31-99 | None |
| A0A1Q7GAH3 | 108-162 | None |
| A0A2V5VZD3 | 9-69 | None |
| A0A1G9SKY8 | 46-106 | None |
| A0A1Q6ZHJ0 | 83-151 | None |
| A0A2N2SDE8 | 12-77 | None |
| A0A1Y1HTZ2 | 98-167 | None |
| G2ED19 | 48-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.