DPCstruct | MC14896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 17.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A658AFU4 | 116-282 | EAVAQGIRDAAALVVESSDIVRAPMPLSELVIGVECGASDATSGLTANATTGLVADWLVEAGGVVILSETDEIVGAEASLAARASKP… |
| A0A842LG25 | 2-127 | KDASAEHRKEFSASELTIGIKCGASDTTSGIVSNPATGVAADRIIGCGGRVIFGETTEIIGAEHILGKRAANKKVSDSLYEIVSRME… |
| F3C2A8 | 261-380 | None |
| A0A2X4V2R6 | 121-244 | None |
| A0A377A9A3 | 180-302 | None |
| A0A378BNG5 | 54-189 | None |
| A0A378A597 | 25-159 | None |
| A0A1V5NMC2 | 50-176 | None |
| A0A509D2W2 | 1-161 | None |
| A0A832BDT2 | 73-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.