DPCstruct | MC14895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2S5W4 | 21-111 | YRVYNLCNNDGYGDYECFPDHELELDLRAAIPRLRAEGFRVRAVNPRLCMIAYGEAVEITLFASGRVIIEHLAPDDPRVALSLTRQL… |
| A0A7L4QB18 | 6-87 | VGICSVEALSAIPKESVRFDLDRASEILEAAGHDLENLSVMVTIQYDGREVTIYRNGRITIYPADSKDIAADIAEKFYDMIE |
| A0A523E8Z9 | 745-821 | None |
| A0A846NYN0 | 4-86 | None |
| A0A397WP07 | 1-79 | None |
| A0A7J3BDU2 | 17-105 | None |
| A0A523SQW6 | 11-100 | None |
| A0A7V2HZE9 | 105-193 | None |
| A0A2D6Q6D5 | 24-105 | None |
| A0A497MPJ2 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.