DPCstruct | MC14894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2RC70 | 18-87 | QKKEFYQNGYGISIIPDVNNLELFEVAVLKGDKDNCVLCFDTHITDDVIKGLTADEVEMIKIEIKGLRKG |
| A0A7D5P3L4 | 5-84 | RIHKIYRFPNDYGASVVNNPEGLHLFSGAFRMYVLRYTSPPPENCWEIADDTPITDGTLELKDWGEVESVLKRIMALPRP |
| A0A6N2Z2R8 | 7-92 | None |
| A0A2D6XM01 | 4-87 | None |
| A0A4S4CCQ7 | 8-112 | None |
| A0A419IRE7 | 19-99 | None |
| A0A6P2GTS0 | 7-89 | None |
| A0A843GGE3 | 34-118 | None |
| A0A6N3C0J8 | 6-81 | None |
| A0A1M6P2W0 | 11-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.