DPCstruct | MC1489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4QV73 | 68-161 | CDPGLCLLPNCFCTKNGTDTPGNLVPSQTPQMITLTFDGPVNHENWDIYTKQLLNADRKNPNGCPIKATFFVSHPYTNYRHVQKLWN… |
| A0A2S2NT67 | 1-63 | MITITFDDAINNNNIELYKEIFNGKRRNPNGCDIKATFFVSHKYTNYSAVQETHRKGHEIAVH |
| A0A1Y1L5N1 | 483-587 | None |
| A0A0N5DA15 | 222-314 | None |
| A0A1Y2H9Y0 | 212-304 | None |
| A0A1S8VQJ1 | 24-120 | None |
| A0A7R9LQK1 | 25-117 | None |
| A0A5B7DQF3 | 37-147 | None |
| A0A0K0E3X8 | 927-1021 | None |
| A0A5B7FI31 | 18-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.