DPCstruct | MC14889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5HA50 | 320-425 | ESEVLENSFIPFLYAQNREQIIQVFYYQENTCVSVFIIDEKGALFTHQHLQSNSNQVLCNYSIFLESMLNHSFYGNDVQVKFYEIQK… |
| A0A656A0Y5 | 9-111 | PLPAVVDSFASEGLVQFFFEDTEKGFNIYVLDEANRVEVYHQFNGEKDEMIASVNSFYTSMLDDSNKLGAKSINFNLPQYYQIIHPE… |
| A0A6I4KPQ7 | 1-85 | None |
| A0A6L2ZQ34 | 732-835 | None |
| A0A378NAF1 | 200-308 | None |
| A0A3B0M151 | 29-132 | None |
| A0A448QMQ3 | 1-108 | None |
| A0A090TDF3 | 279-399 | None |
| A0A377PDW7 | 176-292 | None |
| B8B1P3 | 416-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.