DPCstruct | MC14888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 285 ± 40 aa |
| Standard deviation of domain lengths | 39.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7MKB8 | 19-295 | LAGYPAIAFALISDWSKGLRQFDNGNSTAGRYTIAGGLTMAVGSAVTLEAGLAIAGATTLVPFAGWAAAALVLVGVAIIAGGLYLHA… |
| A0A655ZTL6 | 2-264 | GMIASALETWESWGKFNDSSKTDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILTN… |
| A0A850R735 | 63-329 | None |
| A0A3M3RD51 | 40-329 | None |
| A0A519G7A5 | 116-372 | None |
| A0A369L3D9 | 2-172 | None |
| A0A315WLW2 | 608-984 | None |
| A0A315WME2 | 114-424 | None |
| A0A0Q5FB43 | 449-763 | None |
| A0A3B6Y7Z9 | 31-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.