DPCstruct | MC14887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3JX60 | 1-81 | MHEYVVSTGDTLSSILNQYGIDMGDITQLAAADKELRNLKIGQQLSWTLTADGELQRLTWEVSRRETRTYDRTAANGFKMT |
| A0A655YR16 | 1-79 | MRQGDTLSQVFRNNELPLTDINALVKVEGSDKPLSQIQAGQLIRFKLAENGQLDILQLERNNQSVMFFRLSDGGFGRSK |
| A0A377D5M5 | 4-89 | None |
| A0A2U3BA35 | 130-207 | None |
| A0A418Y9I5 | 100-182 | None |
| A0A7H4NGP1 | 1-86 | None |
| A0A833IU76 | 118-198 | None |
| A0A455W7L4 | 76-167 | None |
| A0A090QQ75 | 61-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.