DPCstruct | MC14886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 398 ± 58 aa |
| Standard deviation of domain lengths | 58.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1S2S0 | 421-837 | KTGDSFDLLISAHAWESDTDSEFCDNATTPNFAIQNIALGSALVAPVGGSDGVAGTASYSHKAQAGANEIGQSISEVGVFRFSAQAP… |
| A0A655YF60 | 1-375 | MLGVNEYTHLLGGTTTIAQKVSEVGVFDFSLFAPTHYLGLDLASANLPIAVTSTGSIGRFIPAYFSVSPMSNVTLDAACKTGNAFSY… |
| I1DRC8 | 763-1101 | None |
| A0A1Y0HJS0 | 1-304 | None |
| A0A7Y3HIJ8 | 634-972 | None |
| A0A7Y1BI03 | 836-1278 | None |
| A0A357LZS0 | 623-1044 | None |
| A0A1F4BH68 | 1-460 | None |
| S6AJF9 | 776-1258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.