DPCstruct | MC14885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Standard deviation of domain lengths | 18.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811E101 | 15-157 | TFYSFALYIAFLLIHILGAHYLYSYVPYNEWLIQYLNFDLNQAMGWSRNMYDRLVHLASGLLLYPVFYRLFQVWLPNLKPFTLFLLV… |
| A0A655Y258 | 8-125 | HTIGAKYTFAEVPFDWFNTLIGSTRNQFDRVAHFSIGLYAYPIAEWLLRKQQTKPWLAYSFALFSLMSLAAAYEIIEWWYAALAGGE… |
| A0A7R6NZY8 | 1-124 | None |
| A0A559KEX0 | 23-165 | None |
| A0A0K2ZYL1 | 4-151 | None |
| A0A1W1DLW6 | 4-126 | None |
| A0A522A7K3 | 145-289 | None |
| A0A6A7KPT8 | 130-266 | None |
| A0A090P8C3 | 11-130 | None |
| A0A525WJ75 | 57-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.