DPCstruct | MC14882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1355 |
|---|---|
| Mean domain length (aa) | 153 ± 25 aa |
| Standard deviation of domain lengths | 25.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.71 |
| Pfam Score | 98.04 |
| Assigned Pfam label(s) | CL0023- PF12631- CL0184- CL0533- PF03909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9VZF9 | 25-174 | RIASFVLLGDAELTQYAAQRLAQRLTHTPFDYLVTMESKGIPLAQALSQLTHHPRFIVLRKSVKPYMTHPHTIAVTAITTHTPQQLV… |
| Q3JYB5 | 177-339 | AVHFNADKPFIFTSGWASPVYIDCRKLISFPRVRRGLMEMAEATILRDVGFEQIDAVAGGETAGIPFAAWIADRMMLPMQYVRKKPK… |
| A0A1V5IJC9 | 1-108 | None |
| A0A0U3USV9 | 251-375 | None |
| A0A6B0GTT7 | 3-126 | None |
| Q00524 | 22-195 | None |
| A0A4U0XRN3 | 68-248 | None |
| S9SN41 | 88-217 | None |
| H0T6N1 | 9-130 | None |
| A0A0G0AUF5 | 59-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.