DPCstruct | MC14881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 334 ± 33 aa |
| Standard deviation of domain lengths | 33.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9YIP4 | 9-337 | DLATQWNFARKLYPIYFELAREFAIDVKPCAELEAGVEMPGKEAVEQANQWLDHMDGAIQVHQLRQFLQTSSLVSQDGIAVLLQHFL… |
| A0A2W0BCW8 | 6-341 | ELLDLISVHHFYVAALETNLGYGISLPQEVIQAQSSSAQTREAMLGVLRWLGVLDLAIAPAMVRDQLYATKDRTSAEALLRYFVKKS… |
| A0A1F2Q6U3 | 2-345 | None |
| A0A7V9C3D2 | 49-419 | None |
| A0A7C6E1G9 | 24-366 | None |
| A0A2V9QMR9 | 1-279 | None |
| A0A7X7YG45 | 19-357 | None |
| A0A1Q7MSZ7 | 9-331 | None |
| A0A7Y4WYG4 | 63-447 | None |
| A0A2W0BWT7 | 5-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.