DPCstruct | MC1488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 137 ± 14 aa |
| Standard deviation of domain lengths | 13.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437B7S5 | 9-131 | SRCINCSLRINKIKSYSIEEINETMSSVLCSWTSPTPIKPDDKLCKECYQILESIEKGELPPPPMLGHMSVCFSCGISLLRCRYHNV… |
| A0A5E4QTZ9 | 1-129 | MRCINCRIAMQRVQRHLITSLSAQHQTRLSRWINIDQPQLSLDTFICHPCFLLLNTEAGEHERLLGHNMVCLGCGKSVKKIRYHNIS… |
| A0A437ASQ0 | 1-109 | None |
| A0A437ATC2 | 58-184 | None |
| A0A6J1NYW9 | 1-150 | None |
| A0A6J1P2V7 | 3-159 | None |
| A0A835GM14 | 176-312 | None |
| A0A7E5WEV7 | 1-152 | None |
| A0A2W1BKV1 | 9-140 | None |
| A0A2W1BLI9 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.