DPCstruct | MC14878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 171 ± 19 aa |
| Standard deviation of domain lengths | 19.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7L2B4 | 171-341 | KHLKEVDTAQTVILMQPQNEVGMFQDIDYNKVSLKLFEKKVPKTLISYLKKNKAHLDAYVKKAWSINNYKTKGTWKEVFGDTPEAKA… |
| A0A143HR87 | 146-318 | RFLKRADGKYKTVIMVQVENEIGMLPSPRDHHPLADAAFASQVPEPLLDYLREHKAQLEPELRAAWRRNGFRNSGSWAQLFGGDTTG… |
| A0A6N7WC36 | 15-179 | None |
| A0A366R0Y0 | 557-744 | None |
| A0A364NFU8 | 159-347 | None |
| A0A0G4NP43 | 499-682 | None |
| C7ZRE7 | 162-351 | None |
| A0A3M1Y8U6 | 3-126 | None |
| A0A1M3FT69 | 75-244 | None |
| A0A3L6NQA2 | 560-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.